Loading...
Statistics
Advertisement

RM-Massivhaus
www.rm-massivhaus.de/

Rm-massivhaus.de

Advertisement
Rm-massivhaus.de is hosted in Germany . Rm-massivhaus.de uses HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: nginx/1.10.1.

Technologies in use by Rm-massivhaus.de

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • nginx/1.10.1

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Rm-massivhaus.de

SSL certificate

    • name: /C=DE/postalCode=47059/ST=Nordrhein-Westfalen/L=Duisburg/street=Ruhrorter Str. 100/O=KONTENT GmbH/OU=Network/OU=Authorized by United SSL/OU=InstantSSL/CN=customssl.com
    • subject:
      • C: DE
      • postalCode: 47059
      • ST: Nordrhein-Westfalen
      • L: Duisburg
      • street: Ruhrorter Str. 100
      • O: KONTENT GmbH
      • OU:
        • 0: Network
        • 1: Authorized by United SSL
        • 2: InstantSSL
      • CN: customssl.com
    • hash: 217b4316
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Organization Validation Secure Server CA
    • version: 2
    • serialNumber: 328025248771560973499584729150864402919
    • validFrom: 150323000000Z
    • validTo: 180323235959Z
    • validFrom_time_t: 1427068800
    • validTo_time_t: 1521849599
    • extensions:
      • authorityKeyIdentifier: keyid:9A:F3:2B:DA:CF:AD:4F:B6:2F:BB:2A:48:48:2A:12:B7:1B:42:C1:24
      • subjectKeyIdentifier: B7:BE:72:ED:82:92:44:E2:A4:37:65:FA:9E:B4:61:BD:36:F5:72:5F
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.1.3.4 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.2
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSAOrganizationValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSAOrganizationValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:customssl.com, DNS:www.customssl.com

Meta - Rm-massivhaus.de

Number of occurences: 1
  • Name:
    Content: text/html; charset=iso-8859-1

Server / Hosting

  • IP: 81.88.32.197
  • Latitude: 51.30
  • Longitude: 9.49
  • Country: Germany

Rname

  • dns1.kontent.com
  • dns2.kontent.com
  • mx.kontent.com
  • mx2.kontent.com

Target

  • hostmaster.kontent.com

HTTP Header Response

HTTP/1.1 200 OK Server: nginx/1.10.1 Date: Tue, 28 Jun 2016 19:14:14 GMT Content-Type: text/html Content-Length: 255 Last-Modified: Fri, 15 May 2015 19:42:39 GMT ETag: "c1a5f8d8-ff-516240bf829c0" Accept-Ranges: bytes Vary: Accept-Encoding X-Cache: MISS from s_xt27 X-Cache-Lookup: MISS from s_xt27:80 Via: 1.1 s_xt27 (squid/3.5.6) Connection: keep-alive

DNS

host: rm-massivhaus.de
  1. class: IN
  2. ttl: 180
  3. type: A
  4. ip: 81.88.32.197
host: rm-massivhaus.de
  1. class: IN
  2. ttl: 180
  3. type: A
  4. ip: 81.88.42.151
host: rm-massivhaus.de
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: dns1.kontent.com
host: rm-massivhaus.de
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: dns2.kontent.com
host: rm-massivhaus.de
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: dns1.kontent.com
  5. rname: hostmaster.kontent.com
  6. serial: 2016060936
  7. refresh: 10800
  8. retry: 3600
  9. expire: 604800
  10. minimum-ttl: 86400
host: rm-massivhaus.de
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 10
  5. target: mx.kontent.com
host: rm-massivhaus.de
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 20
  5. target: mx2.kontent.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.m-massivhaus.de, www.rim-massivhaus.de, www.im-massivhaus.de, www.rom-massivhaus.de, www.om-massivhaus.de, www.rlm-massivhaus.de, www.lm-massivhaus.de, www.rlm-massivhaus.de, www.lm-massivhaus.de, www.r.m-massivhaus.de, www..m-massivhaus.de, www.r-massivhaus.de, www.rmp-massivhaus.de, www.rp-massivhaus.de, www.rmo-massivhaus.de, www.ro-massivhaus.de, www.rmi-massivhaus.de, www.ri-massivhaus.de, www.rmk-massivhaus.de, www.rk-massivhaus.de, www.rm.-massivhaus.de, www.r.-massivhaus.de, www.rmu-massivhaus.de, www.ru-massivhaus.de, www.rmj-massivhaus.de, www.rj-massivhaus.de, www.rmn-massivhaus.de, www.rn-massivhaus.de, www.rm--massivhaus.de, www.r--massivhaus.de, www.rmmassivhaus.de, www.rm-tmassivhaus.de, www.rmtmassivhaus.de, www.rm-gmassivhaus.de, www.rmgmassivhaus.de, www.rm-hmassivhaus.de, www.rmhmassivhaus.de, www.rm-umassivhaus.de, www.rmumassivhaus.de, www.rm-jmassivhaus.de, www.rmjmassivhaus.de, www.rm-xmassivhaus.de, www.rmxmassivhaus.de, www.rm-smassivhaus.de, www.rmsmassivhaus.de, www.rm-amassivhaus.de, www.rmamassivhaus.de, www.rm-massivhaus.de, www.rmmassivhaus.de, www.rm- massivhaus.de, www.rm massivhaus.de, www.rm-assivhaus.de, www.rm-mpassivhaus.de, www.rm-passivhaus.de, www.rm-moassivhaus.de, www.rm-oassivhaus.de, www.rm-miassivhaus.de, www.rm-iassivhaus.de, www.rm-mkassivhaus.de, www.rm-kassivhaus.de, www.rm-m.assivhaus.de, www.rm-.assivhaus.de, www.rm-muassivhaus.de, www.rm-uassivhaus.de, www.rm-mjassivhaus.de, www.rm-jassivhaus.de, www.rm-mnassivhaus.de, www.rm-nassivhaus.de, www.rm-m-assivhaus.de, www.rm--assivhaus.de, www.rm-mssivhaus.de, www.rm-maossivhaus.de, www.rm-mossivhaus.de, www.rm-mapssivhaus.de, www.rm-mpssivhaus.de, www.rm-ma9ssivhaus.de, www.rm-m9ssivhaus.de, www.rm-massivhaus.de, www.rm-mssivhaus.de, www.rm-maissivhaus.de, www.rm-missivhaus.de, www.rm-maussivhaus.de, www.rm-mussivhaus.de, www.rm-masivhaus.de, www.rm-masesivhaus.de, www.rm-maesivhaus.de, www.rm-maswsivhaus.de, www.rm-mawsivhaus.de, www.rm-masdsivhaus.de, www.rm-madsivhaus.de, www.rm-masxsivhaus.de, www.rm-maxsivhaus.de, www.rm-masfsivhaus.de, www.rm-mafsivhaus.de, www.rm-masgsivhaus.de, www.rm-magsivhaus.de, www.rm-mastsivhaus.de, www.rm-matsivhaus.de, www.rm-masivhaus.de, www.rm-masseivhaus.de, www.rm-maseivhaus.de, www.rm-masswivhaus.de, www.rm-maswivhaus.de, www.rm-massdivhaus.de, www.rm-masdivhaus.de, www.rm-massxivhaus.de, www.rm-masxivhaus.de, www.rm-massfivhaus.de, www.rm-masfivhaus.de, www.rm-massgivhaus.de, www.rm-masgivhaus.de, www.rm-masstivhaus.de, www.rm-mastivhaus.de, www.rm-massvhaus.de, www.rm-massirvhaus.de, www.rm-massrvhaus.de, www.rm-massifvhaus.de, www.rm-massfvhaus.de, www.rm-massivvhaus.de, www.rm-massvvhaus.de, www.rm-massikvhaus.de, www.rm-masskvhaus.de, www.rm-massi,vhaus.de, www.rm-mass,vhaus.de, www.rm-massibvhaus.de, www.rm-massbvhaus.de, www.rm-massigvhaus.de, www.rm-massgvhaus.de, www.rm-massitvhaus.de, www.rm-masstvhaus.de, www.rm-massiyvhaus.de, www.rm-massyvhaus.de, www.rm-massiuvhaus.de, www.rm-massuvhaus.de, www.rm-massijvhaus.de, www.rm-massjvhaus.de, www.rm-massimvhaus.de, www.rm-massmvhaus.de, www.rm-massinvhaus.de, www.rm-massnvhaus.de, www.rm-massihaus.de, www.rm-massivyhaus.de, www.rm-massiyhaus.de, www.rm-massivzhaus.de, www.rm-massizhaus.de, www.rm-massivhhaus.de, www.rm-massihhaus.de, www.rm-massivnhaus.de, www.rm-massinhaus.de, www.rm-massivmhaus.de, www.rm-massimhaus.de, www.rm-massivjhaus.de, www.rm-massijhaus.de, www.rm-massivkhaus.de, www.rm-massikhaus.de, www.rm-massivihaus.de, www.rm-massiihaus.de, www.rm-massivaus.de, www.rm-massivheaus.de, www.rm-massiveaus.de, www.rm-massivhdaus.de, www.rm-massivdaus.de, www.rm-massivhcaus.de, www.rm-massivcaus.de, www.rm-massivhuaus.de, www.rm-massivuaus.de, www.rm-massivhjaus.de, www.rm-massivjaus.de, www.rm-massivhaus.de, www.rm-massivaus.de, www.rm-massivhbaus.de, www.rm-massivbaus.de, www.rm-massivhgaus.de, www.rm-massivgaus.de,

Other websites we recently analyzed

  1. Trolleys - Buy hand trolleys & more | Ento, Australia
    We manufacture a wide range of quality trolleys & material handling equipment, and deliver Australia-wide. Call us today to find out more!
    Australia - 203.19.243.91
    G Analytics ID: UA-51455893-1
    Server software: Microsoft-IIS/7.5
    Technology: Html, Javascript, Php, Google Analytics
    Number of meta tags: 9
  2. mississippicriminaldefensetriallawyer.com
    Scottsdale (United States) - 50.63.202.34
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  3. ekybupyn.xyz
    San Francisco (United States) - 104.27.165.181
    Server software: cloudflare-nginx
    Technology: Html
  4. Home
    Scottsdale (United States) - 160.153.136.3
    Server software: DPS/1.0.6
    Technology: CSS, Html, Html5, Javascript
    Number of Javascript: 1
    Number of meta tags: 2
  5. groenlandiafilm.com
    Italy - 195.110.124.188
    Server software: Apache
    Technology: Html
  6. Mobili e arredi - Broni - Pavia - Mobili Arredamenti Tacci
    Mobili Arredamenti Tacci a Broni in provincia di Pavia è un negozio di arredamento che propone arredi e mobili delle migliori marche del settore a prezzi competitivi
    Milan (Italy) - 212.48.12.143
    Server software: Apache/2.2.22 (Ubuntu)
    Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery Cookie, jQuery Fancybox, jQuery UI, Php, SiteCatalyst
    Number of Javascript: 45
    Number of meta tags: 5
  7. Íàáîð èíñòðóìåíòîâ â ÷åìîäàíå, 244 ïðåäìåòà (íîâèíêà)
    Lithuania - 188.165.25.185
    Server software: nginx/1.8.0
    Technology: CloudFront, CSS, Html, Html5, Iframe, Javascript, jQuery, jQuery Fancybox
    Number of Javascript: 9
    Number of meta tags: 4
  8. Welcome to SHADOWHQ.COM
    Scottsdale (United States) - 184.168.221.96
    Server software: Microsoft-IIS/7.5
    Technology: Google Adsense, CSS, Html, Javascript
    Number of Javascript: 3
    Number of meta tags: 1
  9. Petit-Site-Internet
    website description
    France - 193.37.145.77
    Server software: Apache
    Technology: Google Adsense, CSS, Html, Html5, Javascript, Php
    Number of Javascript: 4
    Number of meta tags: 3
  10. Witamy w Małopolskiej Agencji Energii i Środowiska Sp z o.o.
    Konferencja „Małopolska w zdrowej atmosferze. Efektywne spalanie paliw stałych” 29 maja 2014 r. Rejestracja do 28 maja, godz. 12.00.                   Szanowni Państwo serdecznie zapraszamy 29 maja na konferencje pt.: „Małopolska w zdrowej atmosferze. Efektywne spalanie paliw stałych”. Szczegółowy plan konferencji znajduje się tutaj.       DZIAŁANIE […]
    Poland - 89.161.167.208
    Server software: IdeaWebServer/v0.80
    Technology: CSS, Html, Javascript, jQuery, Php, Pingback, SVG, Wordpress
    Number of Javascript: 5
    Number of meta tags: 4

Check Other Websites